Lineage for d3w88b1 (3w88 B:0-312)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091369Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2091448Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)
  8. 2091450Domain d3w88b1: 3w88 B:0-312 [262353]
    Other proteins in same PDB: d3w88a2, d3w88b2
    automated match to d3w88a_
    complexed with cac, edo, fmn, gol, nco, peg, w88

Details for d3w88b1

PDB Entry: 3w88 (more details), 1.4 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-200
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w88b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w88b1 c.1.4.1 (B:0-312) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d3w88b1:

Click to download the PDB-style file with coordinates for d3w88b1.
(The format of our PDB-style files is described here.)

Timeline for d3w88b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w88b2