Lineage for d2mf6b1 (2mf6 B:1-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806127Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2806218Domain d2mf6b1: 2mf6 B:1-128 [262218]
    Other proteins in same PDB: d2mf6a2, d2mf6b2, d2mf6c2, d2mf6d2
    automated match to d2mf6a_

Details for d2mf6b1

PDB Entry: 2mf6 (more details)

PDB Description: Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in the biotin bound form
PDB Compounds: (B:) Avidin, Avidin-related protein 4/5

SCOPe Domain Sequences for d2mf6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mf6b1 b.61.1.1 (B:1-128) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftr
lrtqke

SCOPe Domain Coordinates for d2mf6b1:

Click to download the PDB-style file with coordinates for d2mf6b1.
(The format of our PDB-style files is described here.)

Timeline for d2mf6b1: