SCOPe 2.08: Domain d2mf6a1: 2mf6 A:1-128

Lineage for d2mf6a1 (2mf6 A:1-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d2mf6a1: 2mf6 A:1-128 [258685]
   Other proteins in same PDB: d2mf6a2, d2mf6b2, d2mf6c2, d2mf6d2
   automated match to d4i60a_

Details for d2mf6a1

PDB Entry: 2mf6

PDB Description: Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in the biotin bound form

PDB Compounds: (A:) Avidin, Avidin-related protein 4/5

SCOPe Domain Sequences for d2mf6a1:

Sequence; same for both SEQRES and ATOM records:

>d2mf6a1 b.61.1.1 (A:1-128) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftr
lrtqke

Timeline for d2mf6a1:

• d2mf6a1 first appeared in SCOPe 2.04, called d2mf6a_
  
• d2mf6a1 appears in SCOPe 2.07