SCOPe 2.08: Domain d2g60h3: 2g60 H:1-113

Lineage for d2g60h3 (2g60 H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d2g60h3: 2g60 H:1-113 [262204]
   Other proteins in same PDB: d2g60h2, d2g60l1, d2g60l2

Details for d2g60h3

PDB Entry: 2g60, 1.85 Å

PDB Description: structure of anti-flag m2 fab domain

PDB Compounds: (H:) anti-FLAG M2 Fab heavy chain

SCOPe Domain Sequences for d2g60h3:

Sequence; same for both SEQRES and ATOM records:

>d2g60h3 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evqlqqsggelakpgasvkmsckssgytftayaihwakqaagaglewigyiapaagaaay
naafkgkatlaadkssstaymaaaaltsedsavyycaraaaagadywgqgttltvss

Timeline for d2g60h3:

• d2g60h3 first appeared in SCOPe 2.05
  
• d2g60h3 appears in SCOPe 2.07