Lineage for d2g60l2 (2g60 L:109-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759919Domain d2g60l2: 2g60 L:109-208 [197937]
    Other proteins in same PDB: d2g60h2, d2g60h3, d2g60l1
    automated match to d2jell2

Details for d2g60l2

PDB Entry: 2g60 (more details), 1.85 Å

PDB Description: structure of anti-flag m2 fab domain
PDB Compounds: (L:) anti-FLAG M2 Fab light chain

SCOPe Domain Sequences for d2g60l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g60l2 b.1.1.0 (L:109-208) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivks

SCOPe Domain Coordinates for d2g60l2:

Click to download the PDB-style file with coordinates for d2g60l2.
(The format of our PDB-style files is described here.)

Timeline for d2g60l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g60l1