Lineage for d2a6jb3 (2a6j B:1-121)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755910Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (63 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1755971Domain d2a6jb3: 2a6j B:1-121 [262192]
    Other proteins in same PDB: d2a6ja1, d2a6ja2, d2a6jb2, d2a6jh2, d2a6jl1, d2a6jl2

Details for d2a6jb3

PDB Entry: 2a6j (more details), 2.7 Å

PDB Description: crystal structure analysis of the anti-arsonate germline antibody 36- 65
PDB Compounds: (B:) Germline antibody 36-65 Fab heavy chain

SCOPe Domain Sequences for d2a6jb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6jb3 b.1.1.1 (B:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
s

SCOPe Domain Coordinates for d2a6jb3:

Click to download the PDB-style file with coordinates for d2a6jb3.
(The format of our PDB-style files is described here.)

Timeline for d2a6jb3: