PDB entry 2a6j

View 2a6j on RCSB PDB site
Description: Crystal structure analysis of the anti-arsonate germline antibody 36-65
Class: immune system
Keywords: Germline, Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2005-07-02, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germline antibody 36-65 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6J (0-213)
    Domains in SCOPe 2.05: d2a6ja1, d2a6ja2
  • Chain 'B':
    Compound: Germline antibody 36-65 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6J (0-221)
    Domains in SCOPe 2.05: d2a6jb2, d2a6jb3
  • Chain 'H':
    Compound: Germline antibody 36-65 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6J (0-221)
    Domains in SCOPe 2.05: d2a6jh2, d2a6jh3
  • Chain 'L':
    Compound: Germline antibody 36-65 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6J (0-213)
    Domains in SCOPe 2.05: d2a6jl1, d2a6jl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6jA (A:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6jB (B:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6jH (H:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6jL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec