Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) |
Domain d2a6ja1: 2a6j A:1-107 [197733] Other proteins in same PDB: d2a6ja2, d2a6jb2, d2a6jb3, d2a6jh2, d2a6jh3, d2a6jl2 automated match to d1dqdl1 |
PDB Entry: 2a6j (more details), 2.7 Å
SCOPe Domain Sequences for d2a6ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ja1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleik
Timeline for d2a6ja1: