Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Thrombin [50531] (2 species) |
Domain d1tbq.1: 1tbq L:,H: [26219] Other proteins in same PDB: d1tbqr1, d1tbqr2, d1tbqs1, d1tbqs2 |
PDB Entry: 1tbq (more details), 3.1 Å
SCOPe Domain Sequences for d1tbq.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1tbq.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi qkvidrlgs
Timeline for d1tbq.1: