SCOPe 2.04: Domain d1ycp.2: 1ycp J:,K:,M:

Lineage for d1ycp.2 (1ycp J:,K:,M:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
   Uniprot P00734 333-622

8. Domain d1ycp.2: 1ycp J:,K:,M: [26215]
   mutant

Details for d1ycp.2

PDB Entry: 1ycp, 2.5 Å

PDB Description: the crystal structure of fibrinogen-aa peptide 1-23 (f8y) bound to bovine thrombin explains why the mutation of phe-8 to tyrosine strongly inhibits normal cleavage at arginine-16

PDB Compounds: (J:) epsilon thrombin, (K:) epsilon thrombin, (M:) epsilon thrombin

SCOPe Domain Sequences for d1ycp.2:

Sequence; same for both SEQRES and ATOM records:

>g1ycp.2 b.47.1.2 (J:,K:,M:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
adcglrplfekkqvqdqtekelfesyiegXivegqdaevglspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpry
nwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrreXvqp
svlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvmkspynn
rwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid

Timeline for d1ycp.2:

• d1ycp.2 first appeared (with stable ids) in SCOP 1.55
  
• d1ycp.2 appears in SCOPe 2.03
  
• d1ycp.2 appears in SCOPe 2.05
  
• d1ycp.2 appears in the current release, SCOPe 2.08