Lineage for d3wo2b_ (3wo2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791924Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2791935Protein Interleukin-18 [101782] (1 species)
  7. 2791936Species Human (Homo sapiens) [TaxId:9606] [101783] (4 PDB entries)
  8. 2791938Domain d3wo2b_: 3wo2 B: [262117]
    automated match to d1j0sa_
    complexed with cps, so4

Details for d3wo2b_

PDB Entry: 3wo2 (more details), 2.33 Å

PDB Description: crystal structure of human interleukin-18
PDB Compounds: (B:) Interleukin-18

SCOPe Domain Sequences for d3wo2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wo2b_ b.42.1.2 (B:) Interleukin-18 {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflacekerdlfklilkkedelgdrsimftvqne

SCOPe Domain Coordinates for d3wo2b_:

Click to download the PDB-style file with coordinates for d3wo2b_.
(The format of our PDB-style files is described here.)

Timeline for d3wo2b_: