PDB entry 3wo2

View 3wo2 on RCSB PDB site
Description: Crystal structure of human interleukin-18
Class: immune system
Keywords: beta trefoil fold, IL-1 superfamily, immunity, inflammation, autoimmunity, allergy, interleukin-18 receptor alpha, interleukin-18 receptor beta, serum, IMMUNE SYSTEM
Deposited on 2013-12-19, released 2014-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo2a_
  • Chain 'B':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo2b_
  • Chain 'C':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo2c_
  • Chain 'D':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo2d_
  • Heterogens: CPS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wo2A (A:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wo2B (B:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo2B (B:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wo2C (C:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wo2D (D:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned