Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (4 PDB entries) |
Domain d4whtr2: 4wht R:112-215 [262092] Other proteins in same PDB: d4whtb1, d4whtd1, d4whtf1, d4whth1, d4whtj1, d4whtl1, d4whtn1, d4whtp1, d4whtr1, d4whtt1, d4whtv1, d4whty1 automated match to d1c5da2 |
PDB Entry: 4wht (more details), 2.22 Å
SCOPe Domain Sequences for d4whtr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4whtr2 b.1.1.2 (R:112-215) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr
Timeline for d4whtr2: