Lineage for d4whtr2 (4wht R:112-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753398Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)
  8. 2753405Domain d4whtr2: 4wht R:112-215 [262092]
    Other proteins in same PDB: d4whtb1, d4whtd1, d4whtf1, d4whth1, d4whtj1, d4whtl1, d4whtn1, d4whtp1, d4whtr1, d4whtt1, d4whtv1, d4whty1
    automated match to d1c5da2

Details for d4whtr2

PDB Entry: 4wht (more details), 2.22 Å

PDB Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form
PDB Compounds: (R:) Light chain of the Fab fragment derived from neutralizing antibody 3/11

SCOPe Domain Sequences for d4whtr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whtr2 b.1.1.2 (R:112-215) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

SCOPe Domain Coordinates for d4whtr2:

Click to download the PDB-style file with coordinates for d4whtr2.
(The format of our PDB-style files is described here.)

Timeline for d4whtr2: