SCOPe 2.08: Domain d1mkx.1: 1mkx L:,H:

Lineage for d1mkx.1 (1mkx L:,H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
   Uniprot P00734 333-622

8. Domain d1mkx.1: 1mkx L:,H: [26203]
   chain K is pretrombin-2

Details for d1mkx.1

PDB Entry: 1mkx, 2.2 Å

PDB Description: the co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement of the yppw segment and active site residues upon ligand binding

PDB Compounds: (H:) alpha-thrombin, (L:) alpha-thrombin

SCOPe Domain Sequences for d1mkx.1:

Sequence; same for both SEQRES and ATOM records:

>g1mkx.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
eadcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpry
nwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtt
svaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfv
mkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid

Timeline for d1mkx.1:

• d1mkx.1 first appeared (with stable ids) in SCOP 1.55
  
• d1mkx.1 appears in SCOPe 2.07