Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Thrombin [50531] (2 species) |
Domain d1mkxk_: 1mkx K: [26204] chain K is pretrombin-2 |
PDB Entry: 1mkx (more details), 2.2 Å
SCOPe Domain Sequences for d1mkxk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkxk_ b.47.1.2 (K:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} geadcglrplfekkqvqdqtekelfesyiegrivegqdaevglspwqvmlfrkspqellc gaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihp rynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretw ttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggp fvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid
Timeline for d1mkxk_: