Lineage for d1ucy.2 (1ucy J:,K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405313Protein Thrombin [50531] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
    Uniprot P00734 333-622
  8. 2405316Domain d1ucy.2: 1ucy J:,K: [26200]

Details for d1ucy.2

PDB Entry: 1ucy (more details), 2.2 Å

PDB Description: thrombin complexed with fibrinopeptide a alpha (residues 7-19). three complexes, one with epsilon-thrombin and two with alpha-thrombin
PDB Compounds: (J:) thrombin, (K:) thrombin

SCOPe Domain Sequences for d1ucy.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ucy.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOPe Domain Coordinates for d1ucy.2:

Click to download the PDB-style file with coordinates for d1ucy.2.
(The format of our PDB-style files is described here.)

Timeline for d1ucy.2: