Lineage for d4u2mb1 (4u2m B:2-109)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189361Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2189362Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2189363Species Human (Homo sapiens) [TaxId:9606] [102923] (21 PDB entries)
  8. 2189396Domain d4u2mb1: 4u2m B:2-109 [261996]
    Other proteins in same PDB: d4u2mb3, d4u2mc3, d4u2md3
    automated match to d1r2ba_

Details for d4u2mb1

PDB Entry: 4u2m (more details), 2.23 Å

PDB Description: Crystal structure of a complex of the Miz1- and BCL6 POZ domains.
PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 17,B-cell lymphoma 6 protein

SCOPe Domain Sequences for d4u2mb1:

Sequence, based on SEQRES records: (download)

>d4u2mb1 d.42.1.1 (B:2-109) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvvh
ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitach

Sequence, based on observed residues (ATOM records): (download)

>d4u2mb1 d.42.1.1 (B:2-109) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkvhld
isnaaglgqvlefmytaklslspenvddvlavatflqmqdiitach

SCOPe Domain Coordinates for d4u2mb1:

Click to download the PDB-style file with coordinates for d4u2mb1.
(The format of our PDB-style files is described here.)

Timeline for d4u2mb1: