Lineage for d4tppb_ (4tpp B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (116 PDB entries)
  8. 2342835Domain d4tppb_: 4tpp B: [261983]
    automated match to d2ourb_
    complexed with 35d, gol, so4, zn

Details for d4tppb_

PDB Entry: 4tpp (more details), 2.65 Å

PDB Description: 2-(3-alkoxy-1-azetidinyl) quinolines as novel pde10a inhibitors
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4tppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tppb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
ekvirge

SCOPe Domain Coordinates for d4tppb_:

Click to download the PDB-style file with coordinates for d4tppb_.
(The format of our PDB-style files is described here.)

Timeline for d4tppb_: