PDB entry 4tpp

View 4tpp on RCSB PDB site
Description: 2-(3-alkoxy-1-azetidinyl) quinolines as novel PDE10A inhibitors
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Phosphodiesterase 10A, Quinolines, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2014-06-09, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tppa_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tppb_
  • Heterogens: ZN, SO4, GOL, 35D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tppA (A:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tppA (A:)
    tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
    pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
    aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
    kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
    mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
    ekvir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tppB (B:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tppB (B:)
    tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
    pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
    aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
    kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
    mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
    ekvirge