| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [82796] (129 PDB entries) Uniprot P00533 702-1018 |
| Domain d4rixd_: 4rix D: [261969] Other proteins in same PDB: d4rixa_, d4rixc_ automated match to d3ikaa_ complexed with adp, anp, mg; mutant |
PDB Entry: 4rix (more details), 3.1 Å
SCOPe Domain Sequences for d4rixd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rixd_ d.144.1.7 (D:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissil
ekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd
Timeline for d4rixd_: