Lineage for d4rixd_ (4rix D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981114Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981115Species Human (Homo sapiens) [TaxId:9606] [82796] (133 PDB entries)
    Uniprot P00533 702-1018
  8. 2981288Domain d4rixd_: 4rix D: [261969]
    Other proteins in same PDB: d4rixa_, d4rixc_
    automated match to d3ikaa_
    complexed with adp, anp, mg; mutant

Details for d4rixd_

PDB Entry: 4rix (more details), 3.1 Å

PDB Description: Crystal structure of an EGFR/HER3 kinase domain heterodimer containing the cancer-associated HER3-Q790R mutation
PDB Compounds: (D:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4rixd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rixd_ d.144.1.7 (D:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissil
ekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

SCOPe Domain Coordinates for d4rixd_:

Click to download the PDB-style file with coordinates for d4rixd_.
(The format of our PDB-style files is described here.)

Timeline for d4rixd_: