Lineage for d4rurn_ (4rur N:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677612Domain d4rurn_: 4rur N: [261683]
    Other proteins in same PDB: d4rurb_, d4rurc_, d4rurd_, d4rure_, d4rurf_, d4rurg_, d4rurh_, d4rurm_, d4rurp_, d4rurq_, d4rurr_, d4rurs_, d4rurt_, d4ruru_
    automated match to d1g0un_
    complexed with 3we, mg

Details for d4rurn_

PDB Entry: 4rur (more details), 2.5 Å

PDB Description: yeast 20s proteasome in complex with the alkaloid indolo-phakellin (4)
PDB Compounds: (N:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d4rurn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rurn_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d4rurn_:

Click to download the PDB-style file with coordinates for d4rurn_.
(The format of our PDB-style files is described here.)

Timeline for d4rurn_: