SCOPe 2.08: Domain d4uyeb_: 4uye B:

Lineage for d4uyeb_ (4uye B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d4uyeb_: 4uye B: [261456]
   automated match to d4lc2a_
   complexed with 9f9, edo

Details for d4uyeb_

PDB Entry: 4uye, 1.65 Å

PDB Description: bromodomain of human brpf1 with n-1,3-dimethyl-2-oxo-6-(piperidin-1- yl)-2,3-dihydro-1h-1,3-benzodiazol-5-yl-2-methoxybenzamide

PDB Compounds: (B:) Peregrin

SCOPe Domain Sequences for d4uyeb_:

Sequence; same for both SEQRES and ATOM records:

>d4uyeb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryl
nfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqae

Timeline for d4uyeb_:

• d4uyeb_ first appeared in SCOPe 2.04
  
• d4uyeb_ appears in SCOPe 2.07