Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225345] (2 PDB entries) |
Domain d4usja_: 4usj A: [261451] automated match to d2rd5b_ complexed with adp, arg, atp, gln, mg, nlg, x2w |
PDB Entry: 4usj (more details), 2.85 Å
SCOPe Domain Sequences for d4usja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4usja_ c.73.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dyrveilseslpfiqkfrgktivvkyggaamtspelkssvvsdlvllacvglrpilvhgg gpdinrylkqlnipaefrdglrvtdattmeivsmvlvgkvnknlvslinaagatavglsg hdgrlltarpvpnsaqlgfvgevarvdpsvlrplvdygyipviasvaaddsgqayninad tvagelaaalgaeklilltdvagilenkedpsslikeidikgvkkmiedgkvaggmipkv kccirslaqgvktasiidgrrqhsllheimsdegagtmitg
Timeline for d4usja_: