SCOPe 2.08: Domain d4usja_: 4usj A:

Lineage for d4usja_ (4usj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225345] (2 PDB entries)

8. Domain d4usja_: 4usj A: [261451]
   automated match to d2rd5b_
   complexed with adp, arg, atp, gln, mg, nlg, x2w

Details for d4usja_

PDB Entry: 4usj, 2.85 Å

PDB Description: N-acetylglutamate kinase from Arabidopsis thaliana in complex with PII from Chlamydomonas reinhardtii

PDB Compounds: (A:) acetylglutamate kinase, chloroplastic

SCOPe Domain Sequences for d4usja_:

Sequence; same for both SEQRES and ATOM records:

>d4usja_ c.73.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dyrveilseslpfiqkfrgktivvkyggaamtspelkssvvsdlvllacvglrpilvhgg
gpdinrylkqlnipaefrdglrvtdattmeivsmvlvgkvnknlvslinaagatavglsg
hdgrlltarpvpnsaqlgfvgevarvdpsvlrplvdygyipviasvaaddsgqayninad
tvagelaaalgaeklilltdvagilenkedpsslikeidikgvkkmiedgkvaggmipkv
kccirslaqgvktasiidgrrqhsllheimsdegagtmitg

Timeline for d4usja_:

• d4usja_ first appeared in SCOPe 2.04
  
• d4usja_ appears in SCOPe 2.07