Lineage for d4r9ud_ (4r9u D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596847Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1597093Protein automated matches [190723] (7 species)
    not a true protein
  7. 1597103Species Escherichia coli [TaxId:83333] [261141] (1 PDB entry)
  8. 1597105Domain d4r9ud_: 4r9u D: [261398]
    automated match to d2qi9c_
    complexed with anp, lda, mg

Details for d4r9ud_

PDB Entry: 4r9u (more details), 2.79 Å

PDB Description: Structure of vitamin B12 transporter BtuCD in a nucleotide-bound outward facing state
PDB Compounds: (D:) Vitamin B12 import ATP-binding protein btuD

SCOPe Domain Sequences for d4r9ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9ud_ c.37.1.12 (D:) automated matches {Escherichia coli [TaxId: 83333]}
sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq
pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg
rstnqlsggewqrvrlaavvlqitpqanpagqlllldqpmcsldvaqqsaldkilsalsq
qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldieg
hrmlisti

SCOPe Domain Coordinates for d4r9ud_:

Click to download the PDB-style file with coordinates for d4r9ud_.
(The format of our PDB-style files is described here.)

Timeline for d4r9ud_: