Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein automated matches [190723] (7 species) not a true protein |
Species Escherichia coli [TaxId:83333] [261141] (1 PDB entry) |
Domain d4r9ud_: 4r9u D: [261398] Other proteins in same PDB: d4r9ua_, d4r9ub_ automated match to d2qi9c_ complexed with anp, lda, mg |
PDB Entry: 4r9u (more details), 2.79 Å
SCOPe Domain Sequences for d4r9ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r9ud_ c.37.1.12 (D:) automated matches {Escherichia coli [TaxId: 83333]} sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg rstnqlsggewqrvrlaavvlqitpqanpagqlllldqpmcsldvaqqsaldkilsalsq qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldieg hrmlisti
Timeline for d4r9ud_: