Lineage for d4phtx1 (4pht X:2-145)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606526Species Vibrio vulnificus [TaxId:216895] [261241] (1 PDB entry)
  8. 1606527Domain d4phtx1: 4pht X:2-145 [261242]
    automated match to d1yf5l2
    complexed with anp, mg, zn

Details for d4phtx1

PDB Entry: 4pht (more details), 2.83 Å

PDB Description: atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
PDB Compounds: (X:) type II secretion system protein l

SCOPe Domain Sequences for d4phtx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4phtx1 c.55.1.0 (X:2-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
sefltvrlsseqyspipwlvwsssqqeviasgelsdwqqlddlknyaeqrpivvlvaasd
vvltevdippgasrqfesmlpylledeiaqdvddlhfsvlakengkaqvcgvdrrwlqhm
ldafraqgldvkrvlpdslalpld

SCOPe Domain Coordinates for d4phtx1:

Click to download the PDB-style file with coordinates for d4phtx1.
(The format of our PDB-style files is described here.)

Timeline for d4phtx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4phtx2
View in 3D
Domains from other chains:
(mouse over for more information)
d4phtz1