| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (42 species) not a true protein |
| Species Vibrio vulnificus [TaxId:216895] [261241] (1 PDB entry) |
| Domain d4phtz1: 4pht Z:2-145 [261246] automated match to d1yf5l2 complexed with anp, mg, zn |
PDB Entry: 4pht (more details), 2.83 Å
SCOPe Domain Sequences for d4phtz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4phtz1 c.55.1.0 (Z:2-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
sefltvrlsseqyspipwlvwsssqqeviasgelsdwqqlddlknyaeqrpivvlvaasd
vvltevdippgasrqfesmlpylledeiaqdvddlhfsvlakengkaqvcgvdrrwlqhm
ldafraqgldvkrvlpdslalpld
Timeline for d4phtz1: