Lineage for d4nnoa_ (4nno A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912847Species Staphylococcus aureus [TaxId:158878] [261218] (2 PDB entries)
  8. 2912848Domain d4nnoa_: 4nno A: [261219]
    automated match to d4k3va_
    complexed with zn

Details for d4nnoa_

PDB Entry: 4nno (more details), 1.17 Å

PDB Description: crystal structure of manganese abc transporter substrate-binding protein mntc from staphylococcus aureus bound to a zinc ion
PDB Compounds: (A:) Lipoprotein

SCOPe Domain Sequences for d4nnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnoa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky
vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky
fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetk
kdifgevytdsigkegtkgdsyykmmksnietvhgsmk

SCOPe Domain Coordinates for d4nnoa_:

Click to download the PDB-style file with coordinates for d4nnoa_.
(The format of our PDB-style files is described here.)

Timeline for d4nnoa_: