SCOPe 2.04: Domain d4nnoa_: 4nno A:

Lineage for d4nnoa_ (4nno A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (23 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [261218] (2 PDB entries)

8. Domain d4nnoa_: 4nno A: [261219]
   automated match to d4k3va_
   complexed with zn

Details for d4nnoa_

PDB Entry: 4nno, 1.17 Å

PDB Description: crystal structure of manganese abc transporter substrate-binding protein mntc from staphylococcus aureus bound to a zinc ion

PDB Compounds: (A:) Lipoprotein

SCOPe Domain Sequences for d4nnoa_:

Sequence; same for both SEQRES and ATOM records:

>d4nnoa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky
vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky
fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetk
kdifgevytdsigkegtkgdsyykmmksnietvhgsmk

Timeline for d4nnoa_:

• d4nnoa_ is new in SCOPe 2.04-stable
  
• d4nnoa_ appears in SCOPe 2.05
  
• d4nnoa_ appears in the current release, SCOPe 2.08