Lineage for d4wbad_ (4wba D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708975Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 1708976Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 1708983Protein automated matches [254616] (4 species)
    not a true protein
  7. 1709003Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries)
  8. 1709007Domain d4wbad_: 4wba D: [260996]
    automated match to d2o1ja_
    complexed with gol, po4; mutant

Details for d4wbad_

PDB Entry: 4wba (more details), 1.8 Å

PDB Description: q/e mutant sa11 nsp4_ccd
PDB Compounds: (D:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d4wbad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wbad_ h.1.13.1 (D:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]}
iekqmdrvvkemrrqlemidklttraieavellkriydklt

SCOPe Domain Coordinates for d4wbad_:

Click to download the PDB-style file with coordinates for d4wbad_.
(The format of our PDB-style files is described here.)

Timeline for d4wbad_: