| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) ![]() not a true superfamily |
| Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
| Protein automated matches [254616] (6 species) not a true protein |
| Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries) |
| Domain d4wbad_: 4wba D: [260996] automated match to d2o1ja_ complexed with gol, po4; mutant |
PDB Entry: 4wba (more details), 1.8 Å
SCOPe Domain Sequences for d4wbad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wbad_ h.1.13.1 (D:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]}
iekqmdrvvkemrrqlemidklttraieavellkriydklt
Timeline for d4wbad_:
View in 3DDomains from other chains: (mouse over for more information) d4wbaa_, d4wbab_, d4wbac_, d4wbae_ |