Lineage for d1iht.1 (1iht L:,H:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802802Protein Thrombin [50531] (2 species)
  7. 802849Species Human (Homo sapiens) [TaxId:9606] [50532] (164 PDB entries)
    Uniprot P00734 331-361,364-421
    Uniprot P00734 334-360 364-510 518-619
    Uniprot P00734 328-620
    Uniprot P00734 355-621
    Uniprot P00734 328-620
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 802890Domain d1iht.1: 1iht L:,H: [26094]
    complexed with fbe, ptl

Details for d1iht.1

PDB Entry: 1iht (more details), 2.1 Å

PDB Description: crystal structure of the complex of human alpha-thrombin and non-hydrolyzable bifunctional inhibitors, hirutonin-2 and hirutonin-6
PDB Compounds: (H:) alpha-thrombin (large subunit), (L:) alpha-thrombin (small subunit)

SCOP Domain Sequences for d1iht.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1iht.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
geadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1iht.1:

Click to download the PDB-style file with coordinates for d1iht.1.
(The format of our PDB-style files is described here.)

Timeline for d1iht.1: