SCOPe 2.04: Domain d4ospc_: 4osp C:

Lineage for d4ospc_ (4osp C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Streptomyces fradiae [TaxId:1906] [259879] (1 PDB entry)

8. Domain d4ospc_: 4osp C: [260930]
   automated match to d4kwib_
   complexed with 2v4, nap

Details for d4ospc_

PDB Entry: 4osp, 2.25 Å

PDB Description: the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin

PDB Compounds: (C:) Oxygenase-reductase

SCOPe Domain Sequences for d4ospc_:

Sequence; same for both SEQRES and ATOM records:

>d4ospc_ c.2.1.0 (C:) automated matches {Streptomyces fradiae [TaxId: 1906]}
gkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafsv
laelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvavn
akapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgsr
nitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaflagddarwitg
syldasggtllg

Timeline for d4ospc_:

• d4ospc_ is new in SCOPe 2.04-stable
  
• d4ospc_ appears in SCOPe 2.05
  
• d4ospc_ appears in the current release, SCOPe 2.08