Lineage for d4w9jg_ (4w9j G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637478Protein Elongin B [54246] (2 species)
  7. 1637479Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries)
  8. 1637498Domain d4w9jg_: 4w9j G: [260847]
    Other proteins in same PDB: d4w9jk_
    automated match to d4b9ka_
    complexed with 3jh

Details for d4w9jg_

PDB Entry: 4w9j (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-((S)-2-acetamido-4-methylpentanamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 13)
PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9jg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9jg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9jg_:

Click to download the PDB-style file with coordinates for d4w9jg_.
(The format of our PDB-style files is described here.)

Timeline for d4w9jg_: