SCOPe 2.04: Domain d4w9jg_: 4w9j G:

Lineage for d4w9jg_ (4w9j G:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Elongin B [54246] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries)

8. Domain d4w9jg_: 4w9j G: [260847]
   Other proteins in same PDB: d4w9jk_
   automated match to d4b9ka_
   complexed with 3jh

Details for d4w9jg_

PDB Entry: 4w9j, 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-((S)-2-acetamido-4-methylpentanamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 13)

PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9jg_:

Sequence; same for both SEQRES and ATOM records:

>d4w9jg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

Timeline for d4w9jg_:

• d4w9jg_ is new in SCOPe 2.04-stable
  
• d4w9jg_ appears in SCOPe 2.05
  
• d4w9jg_ appears in the current release, SCOPe 2.08