| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
| Domain d4w9jg_: 4w9j G: [260847] Other proteins in same PDB: d4w9jb_, d4w9jc_, d4w9je_, d4w9jf_, d4w9jh_, d4w9ji_, d4w9jk1, d4w9jk2, d4w9jl_ automated match to d4b9ka_ complexed with 3jh |
PDB Entry: 4w9j (more details), 2.2 Å
SCOPe Domain Sequences for d4w9jg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9jg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4w9jg_: