Lineage for d4r9ma_ (4r9m A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209817Species Escherichia coli [TaxId:83333] [260781] (2 PDB entries)
  8. 2209818Domain d4r9ma_: 4r9m A: [260782]
    automated match to d3eg7b_
    complexed with mg

Details for d4r9ma_

PDB Entry: 4r9m (more details), 2.9 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from escherichia coli
PDB Compounds: (A:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d4r9ma_:

Sequence, based on SEQRES records: (download)

>d4r9ma_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mpsahsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrf
vvecdgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlykl
ylivdkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylae

Sequence, based on observed residues (ATOM records): (download)

>d4r9ma_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mpsahsvklrpleredlryvhqldsvmrywfeepyeafvelsdlydkhihdqserrfvve
cdgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyli
vdkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylae

SCOPe Domain Coordinates for d4r9ma_:

Click to download the PDB-style file with coordinates for d4r9ma_.
(The format of our PDB-style files is described here.)

Timeline for d4r9ma_: