Lineage for d4r17v_ (4r17 V:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2599801Domain d4r17v_: 4r17 V: [260775]
    Other proteins in same PDB: d4r17a_, d4r17e_, d4r17g_, d4r17i_, d4r17j_, d4r17k_, d4r17l_, d4r17n_, d4r17o_, d4r17s_, d4r17u_, d4r17w_, d4r17x_, d4r17y_, d4r17z_
    automated match to d4eu2i_
    complexed with 3k4, mg

Details for d4r17v_

PDB Entry: 4r17 (more details), 2.1 Å

PDB Description: Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4r17v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r17v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4r17v_:

Click to download the PDB-style file with coordinates for d4r17v_.
(The format of our PDB-style files is described here.)

Timeline for d4r17v_: