SCOPe 2.04: Domain d4qpld_: 4qpl D:

Lineage for d4qpld_ (4qpl D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)

8. Domain d4qpld_: 4qpl D: [260760]
   automated match to d2yhob_
   complexed with v3l, zn

Details for d4qpld_

PDB Entry: 4qpl, 1.9 Å

PDB Description: crystal structure of rnf146(ring-wwe)/ubch5a/iso-adpr complex

PDB Compounds: (D:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d4qpld_:

Sequence; same for both SEQRES and ATOM records:

>d4qpld_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhhhhamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltv
hfptdypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpn
pddplvpdiaqiyksdkekynrharewtqkyam

Timeline for d4qpld_:

• d4qpld_ is new in SCOPe 2.04-stable
  
• d4qpld_ appears in SCOPe 2.05
  
• d4qpld_ appears in the current release, SCOPe 2.08, called d4qpld1