SCOPe 2.08: Domain d4o4ga2: 4o4g A:430-552

Lineage for d4o4ga2 (4o4g A:430-552)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries)

8. Domain d4o4ga2: 4o4g A:430-552 [260719]
   Other proteins in same PDB: d4o4ga1, d4o4ga3, d4o4gb_
   automated match to d2ykna2
   complexed with 2rt

Details for d4o4ga2

PDB Entry: 4o4g, 2.71 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 4- ((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4o4ga2:

Sequence; same for both SEQRES and ATOM records:

>d4o4ga2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d4o4ga2:

• d4o4ga2 first appeared in SCOPe 2.04
  
• d4o4ga2 appears in SCOPe 2.07