Lineage for d4o4ga1 (4o4g A:1-429)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3017298Protein automated matches [190211] (7 species)
    not a true protein
  7. 3017329Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries)
  8. 3017339Domain d4o4ga1: 4o4g A:1-429 [260718]
    Other proteins in same PDB: d4o4ga2, d4o4ga3, d4o4gb_
    automated match to d2ykna1
    complexed with 2rt

Details for d4o4ga1

PDB Entry: 4o4g (more details), 2.71 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 4- ((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4o4ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4ga1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d4o4ga1:

Click to download the PDB-style file with coordinates for d4o4ga1.
(The format of our PDB-style files is described here.)

Timeline for d4o4ga1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4o4gb_