SCOPe 2.08: Domain d4o4ga1: 4o4g A:1-429

Lineage for d4o4ga1 (4o4g A:1-429)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (7 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries)

8. Domain d4o4ga1: 4o4g A:1-429 [260718]
   Other proteins in same PDB: d4o4ga2, d4o4ga3, d4o4gb_
   automated match to d2ykna1
   complexed with 2rt

Details for d4o4ga1

PDB Entry: 4o4g, 2.71 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 4- ((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4o4ga1:

Sequence; same for both SEQRES and ATOM records:

>d4o4ga1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d4o4ga1:

• d4o4ga1 first appeared in SCOPe 2.04
  
• d4o4ga1 appears in SCOPe 2.07