SCOPe 2.05: Domain d4wf2a1: 4wf2 A:3-63

Lineage for d4wf2a1 (4wf2 A:3-63)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries)

8. Domain d4wf2a1: 4wf2 A:3-63 [260607]
   Other proteins in same PDB: d4wf2a2, d4wf2a3
   automated match to d1biaa1
   complexed with btx

Details for d4wf2a1

PDB Entry: 4wf2, 2.31 Å

PDB Description: structure of e. coli bira g142a bound to biotinol-5'-amp

PDB Compounds: (A:) Bifunctional ligase/repressor BirA

SCOPe Domain Sequences for d4wf2a1:

Sequence; same for both SEQRES and ATOM records:

>d4wf2a1 a.4.5.0 (A:3-63) automated matches {Escherichia coli [TaxId: 83333]}
dntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpe
p

Timeline for d4wf2a1:

• d4wf2a1 first appeared in SCOPe 2.04
  
• d4wf2a1 appears in SCOPe 2.06
  
• d4wf2a1 appears in the current release, SCOPe 2.08