![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries) |
![]() | Domain d4wf2a1: 4wf2 A:3-63 [260607] Other proteins in same PDB: d4wf2a2, d4wf2a3 automated match to d1biaa1 complexed with btx |
PDB Entry: 4wf2 (more details), 2.31 Å
SCOPe Domain Sequences for d4wf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wf2a1 a.4.5.0 (A:3-63) automated matches {Escherichia coli [TaxId: 83333]} dntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpe p
Timeline for d4wf2a1: