SCOPe 2.07: Domain d4r4be1: 4r4b E:1-106

Lineage for d4r4be1 (4r4b E:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4r4be1: 4r4b E:1-106 [260582]
   Other proteins in same PDB: d4r4ba2, d4r4bc2, d4r4be2, d4r4bl2
   automated match to d2fjha1
   complexed with nag, so4

Details for d4r4be1

PDB Entry: 4r4b, 2.2 Å

PDB Description: crystal structure of the anti-hiv-1 antibody 2.2c

PDB Compounds: (E:) fab 2.2c light chain

SCOPe Domain Sequences for d4r4be1:

Sequence, based on SEQRES records:

>d4r4be1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsfvsasvgdrvtitcrasqgissylawyqqkpgkapklviyaastlqsgvps
rfsgsgsgteftltisslqpedfatyycqhliglrsfgqgtklei

Sequence, based on observed residues (ATOM records):

>d4r4be1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsfvsasvgdrvtitcrasqgissylawyqqkpgkapklviyaastlrfsgsg
sgteftltisslqpedfatyycqhliglrsfgqgtklei

Timeline for d4r4be1:

• d4r4be1 first appeared in SCOPe 2.04
  
• d4r4be1 appears in SCOPe 2.06
  
• d4r4be1 appears in the current release, SCOPe 2.08