Lineage for d1ca0.1 (1ca0 A:,B:,C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230291Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 230292Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 230387Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)
  6. 230388Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 230389Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries)
  8. 230430Domain d1ca0.1: 1ca0 A:,B:,C: [26053]
    Other proteins in same PDB: d1ca0d_, d1ca0i_

Details for d1ca0.1

PDB Entry: 1ca0 (more details), 2.1 Å

PDB Description: bovine chymotrypsin complexed to appi

SCOP Domain Sequences for d1ca0.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ca0.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOP Domain Coordinates for d1ca0.1:

Click to download the PDB-style file with coordinates for d1ca0.1.
(The format of our PDB-style files is described here.)

Timeline for d1ca0.1: