Lineage for d1dlk.1 (1dlk A:,B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 167951Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 167952Species Cow (Bos taurus) [TaxId:9913] [50523] (45 PDB entries)
  8. 167989Domain d1dlk.1: 1dlk A:,B: [26051]

Details for d1dlk.1

PDB Entry: 1dlk (more details), 2.14 Å

PDB Description: crystal structure analysis of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor

SCOP Domain Sequences for d1dlk.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dlk.1 b.47.1.2 (A:,B:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvt
tsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsav
clpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdami
cagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqt
laan

SCOP Domain Coordinates for d1dlk.1:

Click to download the PDB-style file with coordinates for d1dlk.1.
(The format of our PDB-style files is described here.)

Timeline for d1dlk.1: