Lineage for d1dlk.1 (1dlk A:,B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2794860Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2794861Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
    Uniprot P00766
  8. 2794940Domain d1dlk.1: 1dlk A:,B: [26051]
    delta-chymotrypsin
    complexed with cl

Details for d1dlk.1

PDB Entry: 1dlk (more details), 2.14 Å

PDB Description: crystal structure analysis of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor
PDB Compounds: (A:) Thrombin light chain, (B:) Thrombin heavy chain

SCOPe Domain Sequences for d1dlk.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dlk.1 b.47.1.2 (A:,B:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvt
tsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsav
clpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdami
cagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqt
laan

SCOPe Domain Coordinates for d1dlk.1:

Click to download the PDB-style file with coordinates for d1dlk.1.
(The format of our PDB-style files is described here.)

Timeline for d1dlk.1: