Lineage for d4r17c1 (4r17 C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993583Domain d4r17c1: 4r17 C:1-234 [260382]
    Other proteins in same PDB: d4r17a_, d4r17c2, d4r17e_, d4r17g_, d4r17i_, d4r17j_, d4r17k_, d4r17l_, d4r17n_, d4r17o_, d4r17q2, d4r17s_, d4r17u_, d4r17w_, d4r17x_, d4r17y_, d4r17z_
    automated match to d1rypd_
    complexed with 3k4, mg

Details for d4r17c1

PDB Entry: 4r17 (more details), 2.1 Å

PDB Description: Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4r17c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r17c1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4r17c1:

Click to download the PDB-style file with coordinates for d4r17c1.
(The format of our PDB-style files is described here.)

Timeline for d4r17c1: